Ak3 Peptide - C-terminal region
Ak3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AA407498, AI506714, AK-3, Ak3l, Ak3l1, Akl3l
UniProt
Q9WTP7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ak3 Rabbit Polyclonal Antibody (orb326130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067274
Preservative
Lyophilized powder
AA Sequence
LTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940836-100 1x 100 µL
Cytokeratin 18 (KRT18/836), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone ID: OTI2G6]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907dd8/imageurl/cf805837.webp)
CF805837 100 µg
Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone ID: OTI2G6]
Sign In for Pricing
View Details 
HA723908 100 µL
Mouse EPO/Erythropoietin Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
TRC-P998428-5MG 5 mg
Pheophorbide A (>80%) (mixture of diastereomers)
Sign In for Pricing
View Details