Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1D1 Peptide - middle region

AKR1D1 Peptide - middle region

Product Specifications

Product Name Alternative

3o5bred, CBAS2, SRD5B1

UniProt

P51857

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKR1D1 Rabbit Polyclonal Antibody (orb584809) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005980

Preservative

Lyophilized powder

AA Sequence

YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DYRK1A shRNA (UAS) - Lentiviral human DYRK1A shRNA (UAS, GFP) (25)
GTR15319847 1 Vial

Lentiviral human DYRK1A shRNA (UAS) - Lentiviral human DYRK1A shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TRIB1 Protein Vector (Mouse) (pPM-C-His)
PV241373 500 ng

TRIB1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
IRS-2 Rabbit Polyclonal Antibody (PE-Cy7)
orb915004 100 µL

IRS-2 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
TRIM62 Rabbit Polyclonal Antibody (C-term)
E28PB1161 100 µL

TRIM62 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details
Bovine Fibrinogen Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-10361R-BF750 100 µL

Bovine Fibrinogen Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
RAB25
331670-01 50 µL

RAB25

Sign In for Pricing
View Details