Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMZ2 Peptide - C-terminal region

AMZ2 Peptide - C-terminal region

Product Specifications

UniProt

A6NLD9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMZ2 Rabbit Polyclonal Antibody (orb330833) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028746

Preservative

Lyophilized powder

AA Sequence

ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMC5 Recombinant Rabbit monoclonal Antibody
HA750596 100 µL

PSMC5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human IgG2 (Immunoglobulin G2) CLIA Kit
E-CL-H1093-01 24 Tests

Human IgG2 (Immunoglobulin G2) CLIA Kit

Sign In for Pricing
View Details
Human IgG2 (Immunoglobulin G2) CLIA Kit
E-CL-H1093-02 48 Tests

Human IgG2 (Immunoglobulin G2) CLIA Kit

Sign In for Pricing
View Details
Human IgG2 (Immunoglobulin G2) CLIA Kit
E-CL-H1093-03 96 Tests

Human IgG2 (Immunoglobulin G2) CLIA Kit

Sign In for Pricing
View Details
SOCS4 (C-term) Goat Polyclonal Antibody
AP15982PU-N 100 µg

SOCS4 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Transmembrane Protein 175 (TMEM175) (NM_001297424) Human Tagged ORF Clone
RG238132 10 µg

Transmembrane Protein 175 (TMEM175) (NM_001297424) Human Tagged ORF Clone

Sign In for Pricing
View Details