Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMZ2 Peptide - C-terminal region

AMZ2 Peptide - C-terminal region

Product Specifications

UniProt

A6NLD9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMZ2 Rabbit Polyclonal Antibody (orb330833) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028746

Preservative

Lyophilized powder

AA Sequence

ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC22A16 activation kit by CRISPRa
GA113874 1 Kit

Human SLC22A16 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR559648 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF568 conjugate, 0.1mg/mL
BNC682859-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1qtnf5 Mouse Gene Knockout Kit (CRISPR)
KN502354 1 Kit

C1qtnf5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Mouse IL-4 (Interleukin 4) ELISA Kit
E-UNEL-M0068-01 5x 96 Tests

Uncoated Mouse IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse IL-4 (Interleukin 4) ELISA Kit
E-UNEL-M0068-02 15x 96 Tests

Uncoated Mouse IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details