Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD39 Peptide - N-terminal region

ANKRD39 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC41816

UniProt

Q53RE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD39 Rabbit Polyclonal Antibody (orb583365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057550

Preservative

Lyophilized powder

AA Sequence

IWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glass Bond
EC-620 25 mL

Glass Bond

Sign In for Pricing
View Details
CF®790 Maleimide
#96108 1x 250 nmol

CF®790 Maleimide

Sign In for Pricing
View Details
Salicylaldehyde Azine
TRC-S087500-1G 1 g

Salicylaldehyde Azine

Sign In for Pricing
View Details
HypoGel® 200 SH
SP20011015004.0.1G 1 g

HypoGel® 200 SH

Sign In for Pricing
View Details
Top1mt Mouse Gene Knockout Kit (CRISPR)
KN518058 1 Kit

Top1mt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Collagen IV (COL4A5) Human Gene Knockout Kit (CRISPR)
KN417680 1 Kit

Collagen IV (COL4A5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details