Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD39 Peptide - N-terminal region

ANKRD39 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC41816

UniProt

Q53RE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD39 Rabbit Polyclonal Antibody (orb583365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057550

Preservative

Lyophilized powder

AA Sequence

IWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (Dendritic Cells Maturation Marker) (C86/2160R), CF405S conjugate, 0.1mg/mL
BNC042160-500 1x 500 µL

CD86 (Dendritic Cells Maturation Marker) (C86/2160R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cephaloridine Monohydrate
TRC-C258600-25MG 25 mg

Cephaloridine Monohydrate

Sign In for Pricing
View Details
Human YBX2 activation kit by CRISPRa
GA109552 1 Kit

Human YBX2 activation kit by CRISPRa

Sign In for Pricing
View Details
PLAGL1 (NM_001080955) Human Over-expression Lysate
LC421139 20 µg

PLAGL1 (NM_001080955) Human Over-expression Lysate

Sign In for Pricing
View Details
PDCD7 Polyclonal Antibody
E-AB-16027-01 20 µL

PDCD7 Polyclonal Antibody

Sign In for Pricing
View Details
PDCD7 Polyclonal Antibody
E-AB-16027-02 60 µL

PDCD7 Polyclonal Antibody

Sign In for Pricing
View Details