Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APBB1IP Peptide - N-terminal region

APBB1IP Peptide - N-terminal region

Product Specifications

Product Name Alternative

INAG1, PREL1, RARP1, RIAM

UniProt

Q7Z5R6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APBB1IP Rabbit Polyclonal Antibody (orb583520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061916

Preservative

Lyophilized powder

AA Sequence

LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (T-Cell Marker) (rSPN/1094), CF405S conjugate, 0.1mg/mL
BNC041858-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/1094), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTTP Human Gene Knockout Kit (CRISPR)
KN413699 1 Kit

MTTP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF405S conjugate, 0.1mg/mL
BNC041869-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AquaphileTM Coelenterazine h, lyophilized solid
#10127-50ug 1x 50 µg

AquaphileTM Coelenterazine h, lyophilized solid

Sign In for Pricing
View Details
APC Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283E-01 50 Tests

APC Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
APC Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283E-02 100 Tests

APC Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details