Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APBB1IP Peptide - N-terminal region

APBB1IP Peptide - N-terminal region

Product Specifications

Product Name Alternative

INAG1, PREL1, RARP1, RIAM

UniProt

Q7Z5R6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APBB1IP Rabbit Polyclonal Antibody (orb583520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061916

Preservative

Lyophilized powder

AA Sequence

LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-L-Idopyranose Pentaacetate
TRC-I192500-1G 1 g

Alpha-L-Idopyranose Pentaacetate

Sign In for Pricing
View Details
HLA-DP (MHC II) (HLA-DPB1/2862R), CF568 conjugate, 0.1mg/mL
BNC682862-100 1x 100 µL

HLA-DP (MHC II) (HLA-DPB1/2862R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF640R conjugate, 0.1mg/mL
BNC402059-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MK 677
TRC-M424990-5MG 5 mg

MK 677

Sign In for Pricing
View Details
Mouse C5a (Complement Component 5a) ELISA Kit
E-EL-M0339-01 24 Tests

Mouse C5a (Complement Component 5a) ELISA Kit

Sign In for Pricing
View Details
Mouse C5a (Complement Component 5a) ELISA Kit
E-EL-M0339-02 48 Tests

Mouse C5a (Complement Component 5a) ELISA Kit

Sign In for Pricing
View Details