Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF1 Peptide - middle region

ARF1 Peptide - middle region

Product Specifications

UniProt

P84077

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARF1 Rabbit Polyclonal Antibody (orb330534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001649

Preservative

Lyophilized powder

AA Sequence

KIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYP siRNA (h)
sc-36597 10 µM

SYP siRNA (h)

Sign In for Pricing
View Details
Mouse Pigg Pre-designed siRNA Set A
SI110540A 1 Each

Mouse Pigg Pre-designed siRNA Set A

Sign In for Pricing
View Details
ZNF814 Lentiviral Activation Particles (h)
sc-418830-LAC 200 µL

ZNF814 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Anti-KRT7 Antibody Picoband® (Dylight488 Conjugate)
A02416-2-Dylight488 100 µg

Anti-KRT7 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
HGF antibody - N-terminal region (ARP44318_P050)
ARP44318_P050 100 µL

HGF antibody - N-terminal region (ARP44318_P050)

Sign In for Pricing
View Details
CHPT1 Protein Vector (Human) (pPB-N-His)
PV069422 500 ng

CHPT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details