Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARIH2 Peptide - N-terminal region

ARIH2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARI2, FLJ10938, FLJ33921, TRIAD1

UniProt

O95376

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARIH2 Rabbit Polyclonal Antibody (orb583781) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006312

Preservative

Lyophilized powder

AA Sequence

MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytochrome c Antibody
CPA9145-01 30 µL

Anti-Cytochrome c Antibody

Sign In for Pricing
View Details
Anti-Cytochrome c Antibody
CPA9145-02 50 μL

Anti-Cytochrome c Antibody

Sign In for Pricing
View Details
Anti-Cytochrome c Antibody
CPA9145-03 100 µL

Anti-Cytochrome c Antibody

Sign In for Pricing
View Details
Anti-Cytochrome c Antibody
CPA9145-04 200 µL

Anti-Cytochrome c Antibody

Sign In for Pricing
View Details
CD112 Antibody
MBS8584188-01 0.1 mL

CD112 Antibody

Sign In for Pricing
View Details
CD112 Antibody
MBS8584188-02 0.1 mL (AF635)

CD112 Antibody

Sign In for Pricing
View Details