Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARIH2 Peptide - N-terminal region

ARIH2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARI2, FLJ10938, FLJ33921, TRIAD1

UniProt

O95376

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARIH2 Rabbit Polyclonal Antibody (orb583781) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006312

Preservative

Lyophilized powder

AA Sequence

MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRASP1/GRIPAP1 Rabbit Polyclonal Antibody
orb1152340 100 µg

GRASP1/GRIPAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NPM1 (C Mutant Specific) Antibody
CST 17944S 100 µL

NPM1 (C Mutant Specific) Antibody

Sign In for Pricing
View Details
3-Nitro-D-tyrosine
TRC-N503883-50MG 50 mg

3-Nitro-D-tyrosine

Sign In for Pricing
View Details
Ctc1 ORF Vector (Rat) (pORF)
ORF065545 1.0 µg DNA

Ctc1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PTPN21 sgRNA CRISPR Lentivector (Human) (Target 2)
K1756903 1.0 µg DNA

PTPN21 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
UBE2G2 Mouse Monoclonal Antibody [Clone:9F2]
E45M13063 100 µg

UBE2G2 Mouse Monoclonal Antibody [Clone:9F2]

Sign In for Pricing
View Details