Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arntl2 Peptide - C-terminal region

Arntl2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4632430A05Rik, BMAL2, CLIF, MGC124257, MOP9, bHLHe6

UniProt

Q2VPD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arntl2 Rabbit Polyclonal Antibody (orb577100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758513

Preservative

Lyophilized powder

AA Sequence

PHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COMMD1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-8034R-PE-Cy5 100 µL

COMMD1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Stichodactyla Helianthus Neurotoxin [Arg22] (ShK)
MBS659583-01 1 mg

Stichodactyla Helianthus Neurotoxin [Arg22] (ShK)

Sign In for Pricing
View Details
Stichodactyla Helianthus Neurotoxin [Arg22] (ShK)
MBS659583-02 5x 1 mg

Stichodactyla Helianthus Neurotoxin [Arg22] (ShK)

Sign In for Pricing
View Details
THBD (Thrombomodulin)
493833 100 µL

THBD (Thrombomodulin)

Sign In for Pricing
View Details
Anti-TLE2 Mouse Monoclonal Antibody [Clone ID: OTI5A6]
M10582 100 µL

Anti-TLE2 Mouse Monoclonal Antibody [Clone ID: OTI5A6]

Sign In for Pricing
View Details
EPHB1/2/3 antibody
MBS5301125-01 0.1 mg

EPHB1/2/3 antibody

Sign In for Pricing
View Details