Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arntl2 Peptide - C-terminal region

Arntl2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4632430A05Rik, BMAL2, CLIF, MGC124257, MOP9, bHLHe6

UniProt

Q2VPD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arntl2 Rabbit Polyclonal Antibody (orb577100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758513

Preservative

Lyophilized powder

AA Sequence

PHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WISP3 Antibody, Biotin conjugated
A38462-100UG 100 µg

WISP3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Glucagon Receptor rabbit pAb
ES2433-01 50 µL

Glucagon Receptor rabbit pAb

Sign In for Pricing
View Details
Glucagon Receptor rabbit pAb
ES2433-02 100 µL

Glucagon Receptor rabbit pAb

Sign In for Pricing
View Details
NXF3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1471008 1.0 µg DNA

NXF3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Hippurate (25 Discs / vl) Hp
DD035-1VL 1 unit

Hippurate (25 Discs / vl) Hp

Sign In for Pricing
View Details
LC3 monoclonal antibody (5H3)
MBS566286-01 0.1 mg

LC3 monoclonal antibody (5H3)

Sign In for Pricing
View Details