Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG12 Peptide - middle region

ATG12 Peptide - middle region

Product Specifications

Product Name Alternative

APG12, APG12L, FBR93, HAPG12

UniProt

O94817

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG12 Rabbit Polyclonal Antibody (orb582261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004698

Preservative

Lyophilized powder

AA Sequence

KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Red Fluorescent SR-FLICA® Caspase-9 (LEHD) Assay Kit
961 100 Tests

Red Fluorescent SR-FLICA® Caspase-9 (LEHD) Assay Kit

Sign In for Pricing
View Details
Tissue Total RNA, Adrenal gland
CR561823 5 µg

Tissue Total RNA, Adrenal gland

Sign In for Pricing
View Details
Human TREM1 Recombinant Rabbit monoclonal Antibody
HA725233 100 µL

Human TREM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
4,4'-DDM
TRC-D195303-250MG 250 mg

4,4'-DDM

Sign In for Pricing
View Details
EXOSC5 (NM_020158) Human Recombinant Protein
TP310665M 100 µg

EXOSC5 (NM_020158) Human Recombinant Protein

Sign In for Pricing
View Details
Human Myelin Associated Glycoprotein (MAG) ELISA Kit
RD-MAG-Hu-01 96 Tests

Human Myelin Associated Glycoprotein (MAG) ELISA Kit

Sign In for Pricing
View Details