Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG12 Peptide - middle region

ATG12 Peptide - middle region

Product Specifications

Product Name Alternative

APG12, APG12L, FBR93, HAPG12

UniProt

O94817

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG12 Rabbit Polyclonal Antibody (orb582261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004698

Preservative

Lyophilized powder

AA Sequence

KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitapivat-d6
TRC-M299831-10MG 10 mg

Mitapivat-d6

Sign In for Pricing
View Details
MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: SPM555]
AM50110PU-T 20 µg

MelanA (MLANA) Mouse Monoclonal Antibody [Clone ID: SPM555]

Sign In for Pricing
View Details
FLJ14213 (PRR5L) Human Gene Knockout Kit (CRISPR)
KN423241 1 Kit

FLJ14213 (PRR5L) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (BF1.1), CF740 conjugate, 0.1mg/mL
BNC742283-500 1x 500 µL

Calcineurin A / PPP3CA (BF1.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse CD96 Protein (His Tag)
PKSM041203-01 10 µg

Recombinant Mouse CD96 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD96 Protein (His Tag)
PKSM041203-02 50 µg

Recombinant Mouse CD96 Protein (His Tag)

Sign In for Pricing
View Details