Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atg9a Peptide - C-terminal region

Atg9a Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU019532, Apg9l1, Atg9, Atg9l1, MGC105176

UniProt

Q3ZAQ4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atg9a Rabbit Polyclonal Antibody (orb584169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003917

Preservative

Lyophilized powder

AA Sequence

AHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPPL1 (NM_001567) Human Over-expression Lysate
LC419859 20 µg

INPPL1 (NM_001567) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS708130 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
CD70 (TNFS7/1026), CF568 conjugate, 0.1mg/mL
BNC681026-100 1x 100 µL

CD70 (TNFS7/1026), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CMV-p65 (CMV100), CF405S conjugate, 0.1mg/mL
BNC040100-100 1x 100 µL

CMV-p65 (CMV100), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZDHHC15 (NM_144969) Human Over-expression Lysate
LY403407 100 µg

ZDHHC15 (NM_144969) Human Over-expression Lysate

Sign In for Pricing
View Details
5H,6H,7H,8H-Imidazo[1,2-a]pyridine-3-sulfonyl Chloride (~85%)
TRC-H325683-25MG 25 mg

5H,6H,7H,8H-Imidazo[1,2-a]pyridine-3-sulfonyl Chloride (~85%)

Sign In for Pricing
View Details