Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atg9a Peptide - C-terminal region

Atg9a Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU019532, Apg9l1, Atg9, Atg9l1, MGC105176

UniProt

Q3ZAQ4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atg9a Rabbit Polyclonal Antibody (orb584169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003917

Preservative

Lyophilized powder

AA Sequence

AHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLILIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Levomefolic Acid-13C,d3
TRC-L375732-1MG 1 mg

Levomefolic Acid-13C,d3

Sign In for Pricing
View Details
Apex2 Mouse Gene Knockout Kit (CRISPR)
KN501393 1 Kit

Apex2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D9]
TA802010BM 100 µL

CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D9]

Sign In for Pricing
View Details
Acetyl-1,2-13C2 Coenzyme A Sodium Salt (~2% Unlabelled)
TRC-A172214-1MG 1 mg

Acetyl-1,2-13C2 Coenzyme A Sodium Salt (~2% Unlabelled)

Sign In for Pricing
View Details
Germinal Center Kinase (MAP4K2) Human Gene Knockout Kit (CRISPR)
KN417608 1 Kit

Germinal Center Kinase (MAP4K2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OR51I1 activation kit by CRISPRa
GA118101 1 Kit

Human OR51I1 activation kit by CRISPRa

Sign In for Pricing
View Details