ATP6AP1 Peptide - middle region
ATP6AP1 Peptide - middle region
Product Specifications
Product Name Alternative
16A, ATP6IP1, ATP6S1, Ac45, CF2, MGC129781, VATPS1, XAP-3, XAP3
UniProt
Q15904
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP6AP1 Rabbit Polyclonal Antibody (orb579382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001174
Preservative
Lyophilized powder
AA Sequence
SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC403813-500 1x 500 µL
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY402704 100 µg
TROY (TNFRSF19) (NM_018647) Human Over-expression Lysate
Sign In for Pricing
View Details ![Elab Fluor® Red 780 Anti-Rat CD45 Antibody[OX-1]](https://cdn.genprice.uk/products/763/68dd1498061270361e7ce66c/imageurl/e-ab-f1227us.webp)
E-AB-F1227US-01 25 µg
Elab Fluor® Red 780 Anti-Rat CD45 Antibody[OX-1]
Sign In for Pricing
View Details E-AB-F1227US-02 100 µg
Elab Fluor® Red 780 Anti-Rat CD45 Antibody[OX-1]
Sign In for Pricing
View Details ![LMAN1 Recombinant Rabbit Monoclonal Antibody [JE55-19]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82a81/imageurl/et7110-98.webp)
ET7110-98 100 µL
LMAN1 Recombinant Rabbit Monoclonal Antibody [JE55-19]
Sign In for Pricing
View Details