Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP1 Peptide - middle region

ATP6AP1 Peptide - middle region

Product Specifications

Product Name Alternative

16A, ATP6IP1, ATP6S1, Ac45, CF2, MGC129781, VATPS1, XAP-3, XAP3

UniProt

Q15904

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP6AP1 Rabbit Polyclonal Antibody (orb579382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001174

Preservative

Lyophilized powder

AA Sequence

SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetonitrile (anhydrous, 99.8%)
TRC-A163895-50ML 50 mL

Acetonitrile (anhydrous, 99.8%)

Sign In for Pricing
View Details
Arhgef18 Mouse Gene Knockout Kit (CRISPR)
KN501530 1 Kit

Arhgef18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS627148 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
Butoxycaine
TRC-B808850-10MG 10 mg

Butoxycaine

Sign In for Pricing
View Details
FUBP1 Recombinant Rabbit Monoclonal Antibody [SY11-04]
ET1605-26 100 µL

FUBP1 Recombinant Rabbit Monoclonal Antibody [SY11-04]

Sign In for Pricing
View Details
2,7-Dichlorofluorene
TRC-D434465-2.5G 2.5 g

2,7-Dichlorofluorene

Sign In for Pricing
View Details