Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT2 Peptide - middle region

B4GALT2 Peptide - middle region

Product Specifications

Product Name Alternative

B4Gal-T2, B4Gal-T3, beta4Gal-T2

UniProt

O60909

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with B4GALT2 Rabbit Polyclonal Antibody (orb579197) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005417

Preservative

Lyophilized powder

AA Sequence

NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Beclin 1 Antibody [Alexa Fluor 647]
NB110-87318AF647 0.05 mL

Rabbit Polyclonal Beclin 1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Monkeypox Virus (strain Zaire-96-I-16) I1L, His Tag Antibody
orb3013136-01 0.1 mg

Monkeypox Virus (strain Zaire-96-I-16) I1L, His Tag Antibody

Sign In for Pricing
View Details
Monkeypox Virus (strain Zaire-96-I-16) I1L, His Tag Antibody
orb3013136-02 1 mg

Monkeypox Virus (strain Zaire-96-I-16) I1L, His Tag Antibody

Sign In for Pricing
View Details
RAB3B AAV Vector (Rat) (CMV)
38334106 1 µg

RAB3B AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
SR9009 50mg
A20888-50 50 mg

SR9009 50mg

Sign In for Pricing
View Details
ENTPD8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
19328061 1.0 µg DNA

ENTPD8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details