Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG4 Peptide - C-terminal region

BAG4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAG-4, SODD

UniProt

O95429

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAG4 Rabbit Polyclonal Antibody (orb331158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004865

Preservative

Lyophilized powder

AA Sequence

EVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEU5 Polyclonal Antibody, APC Conjugated
bs-6395R-APC 100 µL

LEU5 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Ptx4 shRNA (UAS) - Lentiviral mouse Ptx4 shRNA (UAS) (25)
GTR15218849 1 Vial

Lentiviral mouse Ptx4 shRNA (UAS) - Lentiviral mouse Ptx4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human VSIG8 (V-set and immunoglobulin domain containing 8)
MP0214J Each

Magic™ Membrane Protein Human VSIG8 (V-set and immunoglobulin domain containing 8)

Sign In for Pricing
View Details
Rabbit Monoclonal CCL15/MIP-1 delta Antibody (124) [Alexa Fluor 700]
NBP2-89704AF700 0.1 mL

Rabbit Monoclonal CCL15/MIP-1 delta Antibody (124) [Alexa Fluor 700]

Sign In for Pricing
View Details
LATS (Long Acting Thyroid Stimulator) Chicken ELISA Kit
E6062 96 Tests

LATS (Long Acting Thyroid Stimulator) Chicken ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal HDAC3 Antibody (PCRP-HDAC3-3C9) [HRP]
NBP3-14061H 0.1 mL

Mouse Monoclonal HDAC3 Antibody (PCRP-HDAC3-3C9) [HRP]

Sign In for Pricing
View Details