Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG4 Peptide - C-terminal region

BAG4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAG-4, SODD

UniProt

O95429

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAG4 Rabbit Polyclonal Antibody (orb331158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004865

Preservative

Lyophilized powder

AA Sequence

EVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPNS1 Antibody - N-terminal region : HRP (ARP50029_P050-HRP)
ARP50029_P050-HRP 100 µL

SPNS1 Antibody - N-terminal region : HRP (ARP50029_P050-HRP)

Sign In for Pricing
View Details
Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody
abx104305-01 100 µL

Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody

Sign In for Pricing
View Details
Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody
abx104305-02 200 µL

Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody

Sign In for Pricing
View Details
Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody
abx104305-03 1 mL

Regenerating Islet Derived Protein 3 Alpha (REG3a) Antibody

Sign In for Pricing
View Details
Soft Rubber Brayer, 4 in
43372001-1 1 Each

Soft Rubber Brayer, 4 in

Sign In for Pricing
View Details
Blood Group Lewis a Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-12870R-BF350 100 µL

Blood Group Lewis a Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details