Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAG4 Peptide - C-terminal region

BAG4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BAG-4, SODD

UniProt

O95429

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAG4 Rabbit Polyclonal Antibody (orb331158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004865

Preservative

Lyophilized powder

AA Sequence

EVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AARSD1 (PTGES3L-AARSD1) Goat Polyclonal Antibody
TA311194 100 µg

AARSD1 (PTGES3L-AARSD1) Goat Polyclonal Antibody

Sign In for Pricing
View Details
LNP1 (NM_001085451) Human Tagged Lenti ORF Clone
RC224125L3 10 µg

LNP1 (NM_001085451) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KRTAP13 shRNA Plasmid (m)
sc-146578-SH 20 µg

KRTAP13 shRNA Plasmid (m)

Sign In for Pricing
View Details
BC046331 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
13140064 1.0 µg DNA

BC046331 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Caspase-6 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-0151R-BF647 100 µL

Caspase-6 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Camel Cytoglobin ELISA Kit
MBS071930-01 48 Well

Camel Cytoglobin ELISA Kit

Sign In for Pricing
View Details