Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDH2 Peptide - middle region

BDH2 Peptide - middle region

Product Specifications

Product Name Alternative

DHRS6, EFA6R, FLJ13261, PRO20933, UCPA-OR, UNQ6308, SDR15C1

UniProt

Q9BUT1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BDH2 Rabbit Polyclonal Antibody (orb326192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064524

Preservative

Lyophilized powder

AA Sequence

NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRAS Polyclonal Antibody, HRP Conjugated
A52272-050 50 µL

KRAS Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
KLKB1 Rabbit monoclonal antibody
E43S40598 100 µL

KLKB1 Rabbit monoclonal antibody

Sign In for Pricing
View Details
CD14 protein (His tag)
80R-3830 50 ug

CD14 protein (His tag)

Sign In for Pricing
View Details
Casein kinase IIα (E-2) P
sc-365787 P 100 µg - 0.5 mL

Casein kinase IIα (E-2) P

Sign In for Pricing
View Details
Anti-Rock-1 (N311) Antibody
A00722-2 100 µL

Anti-Rock-1 (N311) Antibody

Sign In for Pricing
View Details
UGT1A5 CRISPR All-in-one AAV vector set (with saCas9)(Human)
49116151 3x 1.0 µg DNA

UGT1A5 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details