BDH2 Peptide - middle region
BDH2 Peptide - middle region
Product Specifications
Product Name Alternative
DHRS6, EFA6R, FLJ13261, PRO20933, UCPA-OR, UNQ6308, SDR15C1
UniProt
Q9BUT1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BDH2 Rabbit Polyclonal Antibody (orb326192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064524
Preservative
Lyophilized powder
AA Sequence
NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6388158-01 0.1 mL
OXA1L (Mitochondrial Inner Membrane Protein OXA1L, Hsa, OXA1Hs, Oxidase Assembly 1-like Protein, OXA1-like Protein) (MaxLight 550)
Sign In for Pricing
View Details 
MBS6388158-02 5x 0.1 mL
OXA1L (Mitochondrial Inner Membrane Protein OXA1L, Hsa, OXA1Hs, Oxidase Assembly 1-like Protein, OXA1-like Protein) (MaxLight 550)
Sign In for Pricing
View Details 
AP31048PU-N 250 µL
Cytokeratin 14 (KRT14) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details MBS9318797-01 48 Well
Human Radial spoke head protein 3 homolog, RSPH3 ELISA Kit
Sign In for Pricing
View Details MBS9318797-02 96 Well
Human Radial spoke head protein 3 homolog, RSPH3 ELISA Kit
Sign In for Pricing
View Details MBS9318797-03 5x 96 Well
Human Radial spoke head protein 3 homolog, RSPH3 ELISA Kit
Sign In for Pricing
View Details