Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIP1 Peptide - N-terminal region

BNIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NIP1, SEC20, TRG-8

UniProt

Q12981

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BNIP1 Rabbit Polyclonal Antibody (orb331051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_053582

Preservative

Lyophilized powder

AA Sequence

DFNSPTTPVTFSDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifna2 Mouse Gene Knockout Kit (CRISPR)
KN308131RB 1 Kit

Ifna2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eupatilin
TRC-E938700-5MG 5 mg

Eupatilin

Sign In for Pricing
View Details
Human HEPC (HAMP) activation kit by CRISPRa
GA111734 1 Kit

Human HEPC (HAMP) activation kit by CRISPRa

Sign In for Pricing
View Details
SureStrain™ Premium Cell Strainers
C4070 50 Units/Pack

SureStrain™ Premium Cell Strainers

Sign In for Pricing
View Details
Human AKR7L activation kit by CRISPRa
GA116720 1 Kit

Human AKR7L activation kit by CRISPRa

Sign In for Pricing
View Details
LAMP3 Antibody
KC-9737-01 50 μL

LAMP3 Antibody

Sign In for Pricing
View Details