Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIP1 Peptide - N-terminal region

BNIP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NIP1, SEC20, TRG-8

UniProt

Q12981

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BNIP1 Rabbit Polyclonal Antibody (orb331051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_053582

Preservative

Lyophilized powder

AA Sequence

DFNSPTTPVTFSDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPP1 (CTSC) Human Gene Knockout Kit (CRISPR)
KN414863 1 Kit

DPP1 (CTSC) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CREB (Ab-133) Antibody
8B7053-AAT 50 µg

CREB (Ab-133) Antibody

Sign In for Pricing
View Details
L-Hydroxyprolylglycine
TRC-H876710-10MG 10 mg

L-Hydroxyprolylglycine

Sign In for Pricing
View Details
Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit
E-EL-R2584-01 24 Tests

Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit

Sign In for Pricing
View Details
Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit
E-EL-R2584-02 48 Tests

Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit

Sign In for Pricing
View Details
Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit
E-EL-R2584-03 96 Tests

Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit

Sign In for Pricing
View Details