Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BST2 Peptide - N-terminal region

BST2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD317, TETHERIN

UniProt

Q10589

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BST2 Rabbit Polyclonal Antibody (orb585032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004326

Preservative

Lyophilized powder

AA Sequence

RVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Caspase-9/CASP9 Antibody Picoband®, Cy3 Conjugate
A00080-5-Cy3 100 µg/Vial

Anti-Caspase-9/CASP9 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
FMO4 shRNA Plasmid (m)
sc-105365-SH 20 µg

FMO4 shRNA Plasmid (m)

Sign In for Pricing
View Details
Goat C type lectin domain family 4 member F (CLEC4F) ELISA Kit
GTR10312693 96 Well

Goat C type lectin domain family 4 member F (CLEC4F) ELISA Kit

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Unknown protein from spot 2D-000JYC of 2D-PAGE
MBS1185132-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Unknown protein from spot 2D-000JYC of 2D-PAGE

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Unknown protein from spot 2D-000JYC of 2D-PAGE
MBS1185132-02 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Unknown protein from spot 2D-000JYC of 2D-PAGE

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Unknown protein from spot 2D-000JYC of 2D-PAGE
MBS1185132-03 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Unknown protein from spot 2D-000JYC of 2D-PAGE

Sign In for Pricing
View Details