Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BST2 Peptide - N-terminal region

BST2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD317, TETHERIN

UniProt

Q10589

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BST2 Rabbit Polyclonal Antibody (orb585032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004326

Preservative

Lyophilized powder

AA Sequence

RVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A21 siRNA (Mouse)
MBS8240272-01 15 nmol

SLC22A21 siRNA (Mouse)

Sign In for Pricing
View Details
SLC22A21 siRNA (Mouse)
MBS8240272-02 30 nmol

SLC22A21 siRNA (Mouse)

Sign In for Pricing
View Details
SLC22A21 siRNA (Mouse)
MBS8240272-03 5x 30 nmol

SLC22A21 siRNA (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal Optineurin Antibody [Janelia Fluor 549]
NBP3-00298JF549 0.1 mL

Rabbit Polyclonal Optineurin Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
KD-Validated Anti-PPP4C Mouse Monoclonal Antibody
AGI2095-100 100 µL

KD-Validated Anti-PPP4C Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Polyclonal KRTAP1-5 antibody - C-terminal region
APR17133G 0.05mg

Polyclonal KRTAP1-5 antibody - C-terminal region

Sign In for Pricing
View Details