C13orf28 Peptide - middle region
C13orf28 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ27356, C13orf28
UniProt
Q96KW9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C13orf28 Rabbit Polyclonal Antibody (orb325382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_660291
Preservative
Lyophilized powder
AA Sequence
PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AMM06261G 0.05mg
Monoclonal LGALS3 / Galectin 3 Antibody (clone M3/38), Clone: M3/38
Sign In for Pricing
View Details GTR15374921 1 Vial
Lentiviral human NOL12 sgRNA gene knockout kit - Lentiviral human NOL12 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details LS057179-20ug 20 µg
KIAA1191 (NM_020444) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS7206081-01 48 Well
Sheep Olfactory receptor 10A5 (OR10A5) ELISA Kit
Sign In for Pricing
View Details