Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C13orf28 Peptide - middle region

C13orf28 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ27356, C13orf28

UniProt

Q96KW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C13orf28 Rabbit Polyclonal Antibody (orb325382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660291

Preservative

Lyophilized powder

AA Sequence

PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDL241 Biosimilar (SLAMF7 / CS1 Reference Antibody)
orb2702820-01 1 mg

PDL241 Biosimilar (SLAMF7 / CS1 Reference Antibody)

Sign In for Pricing
View Details
PDL241 Biosimilar (SLAMF7 / CS1 Reference Antibody)
orb2702820-02 5 mg

PDL241 Biosimilar (SLAMF7 / CS1 Reference Antibody)

Sign In for Pricing
View Details
PDL241 Biosimilar (SLAMF7 / CS1 Reference Antibody)
orb2702820-03 100 mg

PDL241 Biosimilar (SLAMF7 / CS1 Reference Antibody)

Sign In for Pricing
View Details
U12 Blocking Peptide
MBS9620640-01 1 mg

U12 Blocking Peptide

Sign In for Pricing
View Details
U12 Blocking Peptide
MBS9620640-02 5x 1 mg

U12 Blocking Peptide

Sign In for Pricing
View Details
Rat Coagulation Factor IX (F9) ELISA Kit
MBS452625-01 48 Tests

Rat Coagulation Factor IX (F9) ELISA Kit

Sign In for Pricing
View Details