Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYMSOS Peptide - N-terminal region

TYMSOS Peptide - N-terminal region

Product Specifications

Product Name Alternative

C18orf56

UniProt

Q8TAI1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TYMSOS Rabbit Polyclonal Antibody (orb583054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012734

Preservative

Lyophilized powder

AA Sequence

MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAMP2 (NM_005697) Human Tagged ORF Clone Lentiviral Particle
RC200262L3V 200 µL

SCAMP2 (NM_005697) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GPR68 3'UTR GFP Stable Cell Line
TU059178 1.0 mL

GPR68 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PKCiota-IN-1
MBS5815169 Inquire

PKCiota-IN-1

Sign In for Pricing
View Details
3- (2-Bromophenyl) -5- (3-nitrophenyl) -1,2,4-oxadiazole
OR59386 1 Each

3- (2-Bromophenyl) -5- (3-nitrophenyl) -1,2,4-oxadiazole

Sign In for Pricing
View Details
MAGI1 (Membrane Associated Guanylate Kinase, WW and PDZ Domain Containing 1, AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3)
248411 100 µg

MAGI1 (Membrane Associated Guanylate Kinase, WW and PDZ Domain Containing 1, AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3)

Sign In for Pricing
View Details
Mouse TMEM173 shRNA Plasmid
abx977787-01 150 µg

Mouse TMEM173 shRNA Plasmid

Sign In for Pricing
View Details