Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYMSOS Peptide - N-terminal region

TYMSOS Peptide - N-terminal region

Product Specifications

Product Name Alternative

C18orf56

UniProt

Q8TAI1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TYMSOS Rabbit Polyclonal Antibody (orb583054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012734

Preservative

Lyophilized powder

AA Sequence

MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ltb4r1 (NM_008519) AAV Particle
MR205333A1V 250 µL

Mouse Ltb4r1 (NM_008519) AAV Particle

Sign In for Pricing
View Details
Biotin-Linked Anti-Chemokine (C-X-C MOTIF) LIGAND 1 (CXCL1)
FY-AB42508-01 1 mL

Biotin-Linked Anti-Chemokine (C-X-C MOTIF) LIGAND 1 (CXCL1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Chemokine (C-X-C MOTIF) LIGAND 1 (CXCL1)
FY-AB42508-02 100 µL

Biotin-Linked Anti-Chemokine (C-X-C MOTIF) LIGAND 1 (CXCL1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Chemokine (C-X-C MOTIF) LIGAND 1 (CXCL1)
FY-AB42508-03 200 µL

Biotin-Linked Anti-Chemokine (C-X-C MOTIF) LIGAND 1 (CXCL1)

Sign In for Pricing
View Details
PLV3-U6-Thbs1-shRNA3-CopGFP-Puro Plasmid
PVT83210 2 µg

PLV3-U6-Thbs1-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
FBRS Rabbit Polyclonal Antibody
TA360639 100 µL

FBRS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details