Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Peptide - middle region

INKA2 Peptide - middle region

Product Specifications

Product Name Alternative

FAM212B, C1orf183

UniProt

Q9NTI7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INKA2 Rabbit Polyclonal Antibody (orb583722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_945120

Preservative

Lyophilized powder

AA Sequence

GDNVFADLVGNWLDLPELEKGGEKGETGGAREPKGEKGQPQELGRRFALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRAP Antibody
KC-6161-01 50 μL

BRAP Antibody

Sign In for Pricing
View Details
BRAP Antibody
KC-6161-02 100 µL

BRAP Antibody

Sign In for Pricing
View Details
BRAP Antibody
KC-6161-03 1 mL

BRAP Antibody

Sign In for Pricing
View Details
5 HT1A (HTR1A) Rabbit Polyclonal Antibody
AP06769PU-N 100 µg

5 HT1A (HTR1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Copper(II) Acetate Monohydrate
TRC-C685245-50G 50 g

Copper(II) Acetate Monohydrate

Sign In for Pricing
View Details
Lansoprazole Sulfone N-Oxide
TRC-L175030-25MG 25 mg

Lansoprazole Sulfone N-Oxide

Sign In for Pricing
View Details