Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Peptide - middle region

INKA2 Peptide - middle region

Product Specifications

Product Name Alternative

FAM212B, C1orf183

UniProt

Q9NTI7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INKA2 Rabbit Polyclonal Antibody (orb583722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_945120

Preservative

Lyophilized powder

AA Sequence

GDNVFADLVGNWLDLPELEKGGEKGETGGAREPKGEKGQPQELGRRFALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PIK3R1 Antibody
RC-6350-01 50 μL

Recombinant PIK3R1 Antibody

Sign In for Pricing
View Details
Recombinant PIK3R1 Antibody
RC-6350-02 100 µL

Recombinant PIK3R1 Antibody

Sign In for Pricing
View Details
Recombinant PIK3R1 Antibody
RC-6350-03 1 mL

Recombinant PIK3R1 Antibody

Sign In for Pricing
View Details
Ubash3b Mouse Gene Knockout Kit (CRISPR)
KN518558 1 Kit

Ubash3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,2,3,4,5,6,7-Heptachloronaphthalene (>90%)
TRC-H265210-1MG 1 mg

1,2,3,4,5,6,7-Heptachloronaphthalene (>90%)

Sign In for Pricing
View Details
HCG-beta (hCGb/459), CF740 conjugate, 0.1mg/mL
BNC740211-500 1x 500 µL

HCG-beta (hCGb/459), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details