Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPRD1B Peptide - middle region

RPRD1B Peptide - middle region

Product Specifications

Product Name Alternative

CREPT, DKFZp434P0735, FLJ44520, dJ1057B20.2, NET60, C20orf77

UniProt

Q9NQG5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPRD1B Rabbit Polyclonal Antibody (orb583602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067038

Preservative

Lyophilized powder

AA Sequence

KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC157 (NM_001017437) Human Tagged ORF Clone Lentiviral Particle
RC210351L3V 200 µL

CCDC157 (NM_001017437) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CXCR7 modulator 2
orb1709967-01 25 mg

CXCR7 modulator 2

Sign In for Pricing
View Details
CXCR7 modulator 2
orb1709967-02 50 mg

CXCR7 modulator 2

Sign In for Pricing
View Details
CXCR7 modulator 2
orb1709967-03 100 mg

CXCR7 modulator 2

Sign In for Pricing
View Details
Tert-Butyl 3,6-diazabicyclo[3.1.1]heptane-3-carboxylate
OR74829-01 250 mg

Tert-Butyl 3,6-diazabicyclo[3.1.1]heptane-3-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 3,6-diazabicyclo[3.1.1]heptane-3-carboxylate
OR74829-02 1 g

Tert-Butyl 3,6-diazabicyclo[3.1.1]heptane-3-carboxylate

Sign In for Pricing
View Details