RPRD1B Peptide - middle region
RPRD1B Peptide - middle region
Product Specifications
Product Name Alternative
CREPT, DKFZp434P0735, FLJ44520, dJ1057B20.2, NET60, C20orf77
UniProt
Q9NQG5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPRD1B Rabbit Polyclonal Antibody (orb583602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067038
Preservative
Lyophilized powder
AA Sequence
KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal SARS-CoV-2 nsp2 Antibody [DyLight 755]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP3-07052IR 0.1 mL
Rabbit Polyclonal SARS-CoV-2 nsp2 Antibody [DyLight 755]
Sign In for Pricing
View Details 
QS1479Ra-01 48 Tests
Quick Step Rat Programmed Cell Death Protein 1 (PD-1) ELISA Kit
Sign In for Pricing
View Details QS1479Ra-02 96 Tests
Quick Step Rat Programmed Cell Death Protein 1 (PD-1) ELISA Kit
Sign In for Pricing
View Details 
MBS6412683-01 0.1 mL
CSNK2A1 (Casein Kinase 2 alpha, CKII, CK2A1, CSNK2A3) (FITC)
Sign In for Pricing
View Details MBS6412683-02 5x 0.1 mL
CSNK2A1 (Casein Kinase 2 alpha, CKII, CK2A1, CSNK2A3) (FITC)
Sign In for Pricing
View Details