Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf49 Peptide - middle region

C3orf49 Peptide - middle region

Product Specifications

Product Name Alternative

MGC17310

UniProt

Q96BT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf49 Rabbit Polyclonal Antibody (orb582112) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW65417

Preservative

Lyophilized powder

AA Sequence

IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSK1 p90 (T359+S363) Rabbit mAb
AB100331 100 µL

RSK1 p90 (T359+S363) Rabbit mAb

Sign In for Pricing
View Details
Assurance Grade Sodium for AA and ICP 1000 ug/mL (1000 PPM) 250mL in 2% HNO3
PLNA2-2T 250 mL

Assurance Grade Sodium for AA and ICP 1000 ug/mL (1000 PPM) 250mL in 2% HNO3

Sign In for Pricing
View Details
PDZD9 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV622698 1.0 µg DNA

PDZD9 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
MTO1 CRISPR/Cas9 KO Plasmid (h)
sc-411808 20 µg

MTO1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human NUDT21 Protein
BP3488-50ug 50 µg

Recombinant Human NUDT21 Protein

Sign In for Pricing
View Details
Lumula
HY-158936 1 Each

Lumula

Sign In for Pricing
View Details