Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf49 Peptide - middle region

C3orf49 Peptide - middle region

Product Specifications

Product Name Alternative

MGC17310

UniProt

Q96BT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C3orf49 Rabbit Polyclonal Antibody (orb582112) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW65417

Preservative

Lyophilized powder

AA Sequence

IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH7A1 Protein Vector (Human) (pPB-His-GST)
PV321199 500 ng

ALDH7A1 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)
MBS2063262-01 0.1 mL

FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)
MBS2063262-02 0.2 mL

FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)
MBS2063262-03 0.5 mL

FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)
MBS2063262-04 1 mL

FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)
MBS2063262-05 5 mL

FITC-Linked Polyclonal Antibody to Activin A Receptor Type I C (ACVR1C)

Sign In for Pricing
View Details