Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA2 Peptide - C-terminal region

CA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CA-II, CAII, Car2

UniProt

P00918

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CA2 Rabbit Polyclonal Antibody (orb584566) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000058

Preservative

Lyophilized powder

AA Sequence

FGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl w-bromocaproate 95%
E05610-01 25 g

Ethyl w-bromocaproate 95%

Sign In for Pricing
View Details
Ethyl w-bromocaproate 95%
E05610-02 100 g

Ethyl w-bromocaproate 95%

Sign In for Pricing
View Details
Anti-NMDAR2A Rabbit Monoclonal Antibody
MA4007-.1 100 µL

Anti-NMDAR2A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PAPOLB (Poly (A) Polymerase beta, PAP-beta, Polynucleotide Adenylyltransferase beta, Testis-specific Poly (A) Polymerase, PAPT, TPAP) (AP) discontinued
130863-AP 100 µL

PAPOLB (Poly (A) Polymerase beta, PAP-beta, Polynucleotide Adenylyltransferase beta, Testis-specific Poly (A) Polymerase, PAPT, TPAP) (AP) discontinued

Sign In for Pricing
View Details
HPK1 Antibody [G24G15]
F4588-20uL 20 µL

HPK1 Antibody [G24G15]

Sign In for Pricing
View Details
UCHL5IP Antibody Blocking Peptide
orb1501809 500 µg

UCHL5IP Antibody Blocking Peptide

Sign In for Pricing
View Details