Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Capsl Peptide - C-terminal region

Capsl Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1308776, Capsl

UniProt

D4A6W9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Capsl Rabbit Polyclonal Antibody (orb325775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099887

Preservative

Lyophilized powder

AA Sequence

HHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® S Br
S30901.100G 100 g

TentaGel® S Br

Sign In for Pricing
View Details
APBB2 Antibody
8C14453-AAT 50 µg

APBB2 Antibody

Sign In for Pricing
View Details
NVL Rabbit Polyclonal Antibody
TA370674 100 µL

NVL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CDNF protein (N-His)
PKSH034175-01 20 µg

Recombinant Human CDNF protein (N-His)

Sign In for Pricing
View Details
Recombinant Human CDNF protein (N-His)
PKSH034175-02 100 µg

Recombinant Human CDNF protein (N-His)

Sign In for Pricing
View Details
BNIP3L Antibody
KC-7917-01 50 μL

BNIP3L Antibody

Sign In for Pricing
View Details