Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP7 Peptide - N-terminal region

CASP7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CMH-1, ICE-LAP3, MCH3

UniProt

P55210

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP7 Rabbit Polyclonal Antibody (orb584191) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_203124

Preservative

Lyophilized powder

AA Sequence

NNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal VCAM-1/CD106 Antibody (2691A) [DyLight 550]
FAB8092L 0.1 mL

Rabbit Monoclonal VCAM-1/CD106 Antibody (2691A) [DyLight 550]

Sign In for Pricing
View Details
At3g12390 Antibody
orb792316 2 mg

At3g12390 Antibody

Sign In for Pricing
View Details
PSCDBP antibody
orb73614 100 µL

PSCDBP antibody

Sign In for Pricing
View Details
NDST2 Rabbit Polyclonal Antibody (BF750)
orb2473336 100 µL

NDST2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
TMTC4, NT (TMTC4, Transmembrane and TPR repeat-containing protein 4) (MaxLight 750)
MBS6356788-01 0.1 mL

TMTC4, NT (TMTC4, Transmembrane and TPR repeat-containing protein 4) (MaxLight 750)

Sign In for Pricing
View Details
TMTC4, NT (TMTC4, Transmembrane and TPR repeat-containing protein 4) (MaxLight 750)
MBS6356788-02 5x 0.1 mL

TMTC4, NT (TMTC4, Transmembrane and TPR repeat-containing protein 4) (MaxLight 750)

Sign In for Pricing
View Details