Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC105 Peptide - C-terminal region

CCDC105 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ40365

UniProt

Q8IYK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC105 Rabbit Polyclonal Antibody (orb325843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775753

Preservative

Lyophilized powder

AA Sequence

DKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EFTUD2 Rabbit pAb
GB111610 100 μL

Anti-EFTUD2 Rabbit pAb

Sign In for Pricing
View Details
Human ADAMTS7 Knockout HEK293T cell line
GTR15403589 1 Vial

Human ADAMTS7 Knockout HEK293T cell line

Sign In for Pricing
View Details
CCL28 Recombinant Protein
OPCD05210-10UG 10 µg

CCL28 Recombinant Protein

Sign In for Pricing
View Details
CD5 Rabbit pAb, IRDye 800CW conjugated
orb2881520 100 µL

CD5 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Human Wolframin, WFS1 ELISA KIT
ELI-14964h 96 Tests

Human Wolframin, WFS1 ELISA KIT

Sign In for Pricing
View Details
Human ZNF444 siRNA
abx940792-01 15 nmol

Human ZNF444 siRNA

Sign In for Pricing
View Details