Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC87 Peptide - C-terminal region

CCDC87 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10786

UniProt

Q9NVE4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC87 Rabbit Polyclonal Antibody (orb583469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060689

Preservative

Lyophilized powder

AA Sequence

ALLARLEWFEGQASNPNRFFKKTNLSSSHFLEENQVRSHLHRKLNLMESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2S1 (NM_001301078) Human Tagged ORF Clone
RG236127 10 µg

AP2S1 (NM_001301078) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human AITR Protein
orb424025-01 2 µg

Human AITR Protein

Sign In for Pricing
View Details
Human AITR Protein
orb424025-02 10 µg

Human AITR Protein

Sign In for Pricing
View Details
Human AITR Protein
orb424025-03 1 mg

Human AITR Protein

Sign In for Pricing
View Details
NEFL Antibody
orb2322044-01 10 µg

NEFL Antibody

Sign In for Pricing
View Details
NEFL Antibody
orb2322044-02 50 µg

NEFL Antibody

Sign In for Pricing
View Details