Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNH Peptide - N-terminal region

CCNH Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAK, p34, p37

UniProt

P51946

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNH Rabbit Polyclonal Antibody (orb573764) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230

Preservative

Lyophilized powder

AA Sequence

PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-a-Tocopherol Quinone
TRC-T526210-250MG 250 mg

D-a-Tocopherol Quinone

Sign In for Pricing
View Details
Human SPATA13 activation kit by CRISPRa
GA116598 1 Kit

Human SPATA13 activation kit by CRISPRa

Sign In for Pricing
View Details
Mucin 6 (MUC6) (CLH5), 1mg/mL
BNUM0891-50 1x 50 µL

Mucin 6 (MUC6) (CLH5), 1mg/mL

Sign In for Pricing
View Details
RhoGAP (ARHGAP5) Human Gene Knockout Kit (CRISPR)
KN417131 1 Kit

RhoGAP (ARHGAP5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS502789 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
L-Norleucine
TRC-N712000-1G 1 g

L-Norleucine

Sign In for Pricing
View Details