Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNH Peptide - N-terminal region

CCNH Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAK, p34, p37

UniProt

P51946

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNH Rabbit Polyclonal Antibody (orb573764) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230

Preservative

Lyophilized powder

AA Sequence

PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: left
CS709720 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/1783R), CF647 conjugate, 0.1mg/mL
BNC471783-100 1x 100 µL

CD45RB (B-Cell Marker) (PTPRC/1783R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pasireotide TFA Salt
TRC-P211010-2.5MG 2.5 mg

Pasireotide TFA Salt

Sign In for Pricing
View Details
FBXO4 (Center) Rabbit Polyclonal Antibody
AP51631PU-N 400 µL

FBXO4 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ɑ-Butyric Acid NHS Ester-ω-Pentynoic (2-Boc-Amino) PEG
1320000-35-70-21.500MG 500 mg

Ɑ-Butyric Acid NHS Ester-ω-Pentynoic (2-Boc-Amino) PEG

Sign In for Pricing
View Details
CD99 Rabbit Polyclonal Antibody
ER1803-81 100 µL

CD99 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details