CD1D Peptide - C-terminal region
CD1D Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD1A, MGC34622, R3
UniProt
P15813
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD1D Rabbit Polyclonal Antibody (orb331214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001757
Preservative
Lyophilized powder
AA Sequence
LEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1136804-01 0.02 mg (E-Coli)
Recombinant Escherichia coli O7:K1 Molecular chaperone Hsp31 and glyoxalase 3 (hchA)
Sign In for Pricing
View Details MBS1136804-02 0.02 mg (Yeast)
Recombinant Escherichia coli O7:K1 Molecular chaperone Hsp31 and glyoxalase 3 (hchA)
Sign In for Pricing
View Details MBS1136804-03 0.1 mg (E-Coli)
Recombinant Escherichia coli O7:K1 Molecular chaperone Hsp31 and glyoxalase 3 (hchA)
Sign In for Pricing
View Details