Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1D Peptide - C-terminal region

CD1D Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD1A, MGC34622, R3

UniProt

P15813

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD1D Rabbit Polyclonal Antibody (orb331214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001757

Preservative

Lyophilized powder

AA Sequence

LEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Epidermal Growth Factor- 100ug
A11-100ug 100 µg

Recombinant Human Epidermal Growth Factor- 100ug

Sign In for Pricing
View Details
Anti- NS protein [Heartland virus]
IT-017-026M5-01 0.1 mg

Anti- NS protein [Heartland virus]

Sign In for Pricing
View Details
Anti- NS protein [Heartland virus]
IT-017-026M5-02 0.5 mg

Anti- NS protein [Heartland virus]

Sign In for Pricing
View Details
4- (Methylamino) oxane-4-carboxylic acid hydrochloride
DXC59585-01 250 mg

4- (Methylamino) oxane-4-carboxylic acid hydrochloride

Sign In for Pricing
View Details
4- (Methylamino) oxane-4-carboxylic acid hydrochloride
DXC59585-02 2.5 g

4- (Methylamino) oxane-4-carboxylic acid hydrochloride

Sign In for Pricing
View Details
SYP Polyclonal Antibody
RA30227-01 50 µL

SYP Polyclonal Antibody

Sign In for Pricing
View Details