Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC2 Peptide - middle region

CDC2 Peptide - middle region

Product Specifications

Product Name Alternative

CDC28A, CDK1, DKFZp686L20222, MGC111195, CDC2, P34CDC2

UniProt

P06493

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC2 Rabbit Polyclonal Antibody (orb583981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_203698

Preservative

Lyophilized powder

AA Sequence

DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQSEC3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV660548 1.0 µg DNA

IQSEC3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit
MBS2500837-01 24 Tests

Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit
MBS2500837-02 48 Tests

Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit
MBS2500837-03 96 Tests

Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit
MBS2500837-04 5x 96 Tests

Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit
MBS2500837-05 10x 96 Tests

Rabbit TPPP (Tubulin Polymerization Promoting Protein) ELISA Kit

Sign In for Pricing
View Details