CDC2 Peptide - middle region
CDC2 Peptide - middle region
Product Specifications
Product Name Alternative
CDC28A, CDK1, DKFZp686L20222, MGC111195, CDC2, P34CDC2
UniProt
P06493
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDC2 Rabbit Polyclonal Antibody (orb583981) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_203698
Preservative
Lyophilized powder
AA Sequence
DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
322394 1 Pack (1 Piece (s) x 1 Piece)
BBP72+-Ultra-5Y Training Services
Sign In for Pricing
View Details 
K0136-30A-Biotin 100 µL
KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, MinK, Potassium Voltage-gated Channel Isk-related Family Member 1) (Biotin)
Sign In for Pricing
View Details 
K1820305 3x 1.0 µg
RHEB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details