CGRRF1 Peptide - middle region
CGRRF1 Peptide - middle region
Product Specifications
Product Name Alternative
CGR19, RNF197
UniProt
Q99675
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CGRRF1 Rabbit Polyclonal Antibody (orb578705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006559
Preservative
Lyophilized powder
AA Sequence
KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682622-100 1x 100 µL
MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB2233-500 1x 500 µL
Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), 0.2mg/mL
Sign In for Pricing
View Details 
BNC680782-100 1x 100 µL
Bcl-2 (BCL2/782), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 